PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008229553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family ARR-B
Protein Properties Length: 551aa    MW: 61278 Da    PI: 6.6367
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008229553.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like871.8e-27308362156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k +++WtpeLH++Fv+aveqL G ++A+P++ilelmk +gLt+++v+SHLQkYR++
  XP_008229553.1 308 KMKVDWTPELHKKFVQAVEQL-GVDQAIPSRILELMKAEGLTRHNVASHLQKYRMH 362
                     5689*****************.********************************96 PP

2Response_reg28.67.1e-11201261109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl+ d++++ +  +++ le  +y +v+++ + +eal  +  +   +++ ++ ++ ++  G+ +++ +++++ +lp i+ +     +++ +++ +G
  XP_008229553.1  20 VLLLDEDNSSAAEIKSKLEAMDY-IVTTFCNDTEALSAFSSNPqsFQVAIVEVNASN--GHGVFQFLETAK-DLPTIMTSNIHCLSTMMKCIALG 110
                     7999999****************.***************776666999999988765..666788888877.9****9999999*********** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a +fl Kp ++++l++
  XP_008229553.1 111 AVEFLRKPLSEDKLRN 126
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.57E-1516134IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.1E-1616165No hitNo description
SMARTSM004480.008918128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011021.99519132IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.7E-820127IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.51E-921131No hitNo description
PROSITE profilePS5129415.081305364IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-26306364IPR009057Homeodomain-like
SuperFamilySSF466897.26E-18307365IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-24308363IPR006447Myb domain, plants
PfamPF002499.8E-9311360IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MVCTANDLQE WKDFPKGLKV LLLDEDNSSA AEIKSKLEAM DYIVTTFCND TEALSAFSSN  60
PQSFQVAIVE VNASNGHGVF QFLETAKDLP TIMTSNIHCL STMMKCIALG AVEFLRKPLS  120
EDKLRNIWQH VVHKAFNAGG SAISESLKPV KESVVSILQI KQETEEQKCK TSVETENVSR  180
VHESDREQSV GSDKYPAPST PQLKQGSRLL ADGDCQDQIN CLSEKESGEN DSESKSAETT  240
CGNPIDEGTV QMSEPQMTRK RVVKEENDSV NGSQHPHNRN SANDVGGAAE NLSKASAPNN  300
SCKSNRKKMK VDWTPELHKK FVQAVEQLGV DQAIPSRILE LMKAEGLTRH NVASHLQKYR  360
MHKRHILPKE DDRRLPHPRD PIQRSYYPQN QKPIMAFPPY HYNNSLSMAP VYPMWGQPGS  420
QPAGVQMWGS PGYPQWQPSE SWHWKPYQGM QADAWGCPVM PPLQGGYPSY PQNAAGFHAG  480
VVDNGCSMQH NSFDLHPAEE VVDKVVKEAI SKPWLPLPLG LKPPSTEGVL DELSRQGICN  540
IPPHINRSNT R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-15306361358ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008229555.10.0PREDICTED: two-component response regulator-like APRR2
RefseqXP_008229553.10.0PREDICTED: two-component response regulator-like APRR2
RefseqXP_008229552.10.0PREDICTED: two-component response regulator-like APRR2
SwissprotQ6LA431e-149APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLM5WCS50.0M5WCS5_PRUPE; Uncharacterized protein
STRINGVIT_02s0012g00570.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-145ARR-B family protein